Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Default
France France
$0.00
Body Butter
2oz Baby Powder Organic Body Butter
2oz Baby Powder Organic Body Butter
$12.99
2oz Egyptien Amber Organic body butter
2oz Egyptien Amber Organic body butter
$19.99
2oz Wild Rose & Jasmine Organic body butter
2oz Wild Rose & Jasmine Organic body butter
$12.99
8oz Vanilla organic Body Butter
8oz Vanilla organic Body Butter
$45.99
8oz Vanilla Rose Organic Body butter
8oz Vanilla Rose Organic Body butter
$45.99
8oz Vinilla & Cinnamon Organic Body Butter
8oz Vinilla & Cinnamon Organic Body Butter
$55.99
8oz Wild Rose & Jasmine Organic Body butter
8oz Wild Rose & Jasmine Organic Body butter
$59.99
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i