USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Default
France France
$0.00
2.5oz Maringa Organic Hair growth oil

2.5oz Maringa Organic Hair growth oil

$17.27 inc. tax
$15.99 ex. tax
? Tax based on Pennsylvania, United States.
2 up to 3 - $13.99 ex. tax per product

2.5oz Maringa  Organic Hair growth oil Cloves, Fenugreek, Soursop Rosemary, Aloe vera., essential oils. Herb infuse hair oil black Castor oil. Support hair growth, dry scalp, helps with scalp health. Hair nurishment. Dandruff.

Product Code: OIzR2Qh
Brand: Madame Warnocks
weight: 2.5 oz
Product Condition: New
Related Products
2.5oz Citronella Organi..
2.5oz Citronella Organi..
$15.99
Product Added to your Cart
x

-------- OR --------

Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i